TBLASTX 2.0.10 [Aug-26-1999]

 

 

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,

Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),

"Gapped BLAST and PSI-BLAST: a new generation of protein database search

programs",  Nucleic Acids Res. 25:3389-3402.

 

Query= gnl|UG|Hs#S1090812 Homo sapiens mRNA for KIAA0692 protein,

partial cds /cds=(0,2353) /gb=AB014592 /gi=3327197 /ug=Hs.100729

/len=4088

         (4088 letters)

 

Database: na_clot.dros

           13,830 sequences; 9,510,273 total letters

 

 

 

                                                                   Score     E

Sequences producing significant alignments:                        (bits)  Value

 

1755_2 EST composition (unordered) : LD11281.5prime,GH14580.5pr...    73  5e-013

10347_1 EST composition (unordered) : GH13043.5prime                  72  1e-012

2496_4 EST composition (unordered) : GM03542.5prime                   33  9e-005

 

>1755_2 EST composition (unordered) :

           LD11281.5prime,GH14580.5prime,LD17956.3prime,

           LD12318.5prime,LD07771.5prime,LD41835.5prime,

           HL02846.5prime,HL03454.5prime,SD04306.5prime,

           LD45996.5prime,LD45457.5prime

           Length = 1078

          

 Score = 72.5 bits (152), Expect = 5e-013

 Identities = 26/55 (47%), Positives = 35/55 (63%)

 Frame = +3 / +1

 

                                                                 

Query: 453 TQDLTAKLRKAVEKGEEDTFSDLIWSNPRYLIGSGDNPTIVQEGCRYNVMHVAAK 617

           T+    + RK +E G  D    +IW NPR+LI SGD PT ++EGCRYN MH+  +

Sbjct: 820 TKQELVEFRKQIEGGHIDRVKRIIWENPRFLISSGDTPTSLKEGCRYNAMHICGQ 984

 

 

  Database: na_clot.dros

    Posted date:  Nov 24, 1999 11:08 AM

  Number of letters in database: 9,510,273

  Number of sequences in database:  13,830

 

Lambda     K      H

   0.318    0.135    0.401

 

 

Matrix: BLOSUM62

Number of Hits to DB: 112115142

Number of Sequences: 13830

Number of extensions: 2057306

Number of successful extensions: 99135

Number of sequences better than 1.0e-003: 3

length of query: 1362

length of database: 3,170,091

effective HSP length: 49

effective length of query: 1313

effective length of database: 2,492,421

effective search space: 3272548773

effective search space used: 3272548773

frameshift window, decay const: 50,  0.1

T: 13

A: 40

X1: 16 ( 7.3 bits)

X2: 0 ( 0.0 bits)

S1: 41 (21.7 bits)

S2: 85 (41.8 bits)